{"product_id":"proteintech-34093-1-ap","title":"Proteintech, 34093-1-AP, CLEC2\/CLEC1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLEC2\/CLEC1B (34093-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC2\/CLEC1B in WB, ELISA applications with reactivity to mouse samples\n34093-1-AP targets CLEC2\/CLEC1B in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-type lectin-like receptor 2 (CLEC2, also known as CLEC1B) is a type II transmembrane receptor of the C-type lectin superfamily, which are characterized by one or more C-type lectin-like domains (CTLDs) (PMID: 10671229; 34177942). CLEC2 contains a single YXXL\/hemi-ITAM (immuno-receptor tyrosine-based activation motif) within its cytoplasmic domain. CLEC-2 is highly expressed on platelets and megakaryocytes and at low levels on other hematopoietic cells, including dendritic cells, neutrophils, monocytes, and macrophages (PMID: 21728173). The first identified ligand for CLEC2 was the platelet-aggregating snake venom protein rhodocytin, and podoplanin has been established as an endogenous ligand for CLEC2 (PMID: 26151067). CLEC2 is involved in thrombosis\/hemostasis, tumor metastasis, and lymphangiogenesis (PMID: 20525685). CLEC2 can be glycosylated and has been detected as 32- and 40-kDa forms in platelets with varying degrees of glycosylation (PMID: 16174766; 25150298; 21781241).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg7521 Product name: Recombinant mouse CLEC-2 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 53-229 aa of NM_019985.3 Sequence: MSVTQQKYLLAEKENLSATLQQLAKKFCQELIRQSEIKTKSTFEHKCSPCATKWRYHGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQSTLDYIAERITSVRWIGLSRQNSKKDWMWEDSSVLRKNGINLSGNTEENMNCAYLHNGKIHPASCKERHYLICERNAGMTRVDQLL Predict reactive species\nFull Name: C-type lectin domain family 1, member b\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: NM_019985.3\nGene Symbol: Clec1b\nGene ID (NCBI): 56760\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9JL99-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886605127849,"sku":"34093-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-34093-1-ap","provider":"Iright","version":"1.0","type":"link"}