{"product_id":"proteintech-51013-2-ap","title":"Proteintech, 51013-2-AP, GRHPR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRHPR (51013-2-AP) by Proteintech is a Polyclonal antibody targeting GRHPR in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n51013-2-AP targets GRHPR in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  human liver tissue,  L02 cells,  MCF-7 cells\nPositive IHC detected in: human liver tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRHPR(Glyoxylate reductase\/hydroxypyruvate reductase) is also named as GLXR and belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The GRHPR gene encodes a predicted 328-amino acid protein with a calculated molecular mass of 35.5 kD. It has glyoxylate reductase (GR), hydroxypyruvate reductase (HPR) and D-glycerate dehydrogenase (DGDH) activities(PMID:16597637). Defects in GRHPR are the cause of hyperoxaluria primary type 2 (HP2)(PMID: 10484776). It can exsit as a homodimer(PMID:16756993).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0484 Product name: Recombinant human GRHPR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-328 aa of BC000605 Sequence: VGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL Predict reactive species\nFull Name: glyoxylate reductase\/hydroxypyruvate reductase\nCalculated Molecular Weight: 328 aa, 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC000605\nGene Symbol: GRHPR\nGene ID (NCBI): 9380\nRRID: AB_2113424\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBQ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887659634857,"sku":"51013-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-51013-2-ap","provider":"Iright","version":"1.0","type":"link"}