{"product_id":"proteintech-60077-1-ig","title":"Proteintech, 60077-1-Ig, RAC2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAC2 (60077-1-Ig) by Proteintech is a Monoclonal antibody targeting RAC2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n60077-1-Ig targets RAC2 in WB, IHC, IF, coIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, MCF-7 cells,  HSC-T6 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAC2, also named as GX, belongs to the small GTPase superfamily and Rho family. RAC2 is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and inactive GDP-bound state. In active state binds to a variety of effector proteins to regulate cellular responses, such as secretory processes, phagocytose of apoptotic cells and epithelial cell polarization. RAC2 augments the production of reactive oxygen species (ROS) by NADPH oxidase. Defects in RAC2 are the cause of neutrophil immunodeficiency syndrome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1202 Product name: Recombinant human RAC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC001485 Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL Predict reactive species\nFull Name: ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC001485\nGene Symbol: RAC2\nGene ID (NCBI): 5880\nRRID: AB_2253445\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15153\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887990755497,"sku":"60077-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60077-1-ig","provider":"Iright","version":"1.0","type":"link"}