{"product_id":"proteintech-60079-1-ig","title":"Proteintech, 60079-1-Ig, BORIS Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BORIS (60079-1-Ig) by Proteintech is a Monoclonal antibody targeting BORIS in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n60079-1-Ig targets BORIS in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Hela cells,  SMMC-7721 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCTCFL, also named BORIS (for brother of the regulator of imprinted sites) is a paralogue of the 11 zinc-finger transcription factor, CTCF. It is predominantly expressed in spermatocytes in the testis, also can be found in tumors and cancer cell lines. It mainly participates in insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. It has a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2\/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1003 Product name: Recombinant human BORIS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-663 aa of BC130486 Sequence: VRSHTGERPFQCCQCSYASRDTYKLKRHMRTHSGEKPYECHICHTRFTQSGTMKIHILQKHGENVPKYQCPHCATIIARKSDLRVHMRNLHAYSAAELKCRYCSAVFHERYALIQHQKTHKNEKRFKCKHCSYACKQERHMTAHIRTHTGEKPFTCLSCNKCFRQKQLLNAHFRKYHDANFIPTVYKCSKCGKGFSRWINLHRHSEKCGSGEAKSAASGKGRRTRKRKQTILKEATKGQKEAAKGWKEAANGDEAAAEEASTTKGEQFPGEMFPVACRETTARVKEEVDEGVTCEMLLNTMDK Predict reactive species\nFull Name: CCCTC-binding factor (zinc finger protein)-like\nCalculated Molecular Weight: 82 kDa, 75 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC130486\nGene Symbol: BORIS\/CTCFL\nGene ID (NCBI): 140690\nRRID: AB_1211604\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8NI51\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888056815785,"sku":"60079-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60079-1-ig","provider":"Iright","version":"1.0","type":"link"}