{"product_id":"proteintech-60092-1-ig","title":"Proteintech, 60092-1-Ig, Prohibitin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Prohibitin (60092-1-Ig) by Proteintech is a Monoclonal antibody targeting Prohibitin in WB, IHC, ELISA applications with reactivity to human, rat, pig samples\n60092-1-Ig targets Prohibitin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue, HeLa cells,  human placenta tissue,  pig heart tissue,  rat heart tissue\nPositive IHC detected in: human liver tissue, human kidney tissue,  human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProhibitin, also known as PHB, a member of the Band-7 family of proteins, is widely distributed in bacteria, plants, yeast, protozoa and mammals and is important in cell proliferation, differentiation and apoptosis (PMID: 20840588 ). This protein localizes to the inner membrane of mitochondria, where it acts as a chaperone protein, and is also found in the nucleus, where it negatively regulates transcription (PMID: 18558096). Recent study confirmed that the expression and distribution of PHB, which is a nuclear matrix protein, affect the apoptosis of HaCaT cells and its co-localization with specific gene products connected with cell apoptosis (PMID: 24402549).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1240 Product name: Recombinant human Prohibitin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC013401 Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ Predict reactive species\nFull Name: prohibitin\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC013401\nGene Symbol: Prohibitin\nGene ID (NCBI): 5245\nRRID: AB_2252403\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P35232\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888022769833,"sku":"60092-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60092-1-ig","provider":"Iright","version":"1.0","type":"link"}