{"product_id":"proteintech-60113-1-ig","title":"Proteintech, 60113-1-Ig, SERPINA10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SERPINA10 (60113-1-Ig) by Proteintech is a Monoclonal antibody targeting SERPINA10 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, rat, pig samples\n60113-1-Ig targets SERPINA10 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  pig liver tissue,  rat liver tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1500-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSERPINA10 belongs to the serpin family. It is predominantly expressed in the liver and secreted in plasma. It inhibits the activity of coagulation factors Xa and XIa in the presence of protein Z, calcium and phospholipid. Mutations in this gene are associated with venous thrombosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2420 Product name: Recombinant human SERPINA10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 137-444 aa of BC022261 Sequence: KPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL Predict reactive species\nFull Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10\nCalculated Molecular Weight: 444 aa, 51 kDa\nObserved Molecular Weight: 51 kDa\nGenBank Accession Number: BC022261\nGene Symbol: SERPINA10\nGene ID (NCBI): 51156\nRRID: AB_2301526\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UK55\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888075100329,"sku":"60113-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60113-1-ig","provider":"Iright","version":"1.0","type":"link"}