{"product_id":"proteintech-60130-1-ig","title":"Proteintech, 60130-1-Ig, Gastrokine 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Gastrokine 1 (60130-1-Ig) by Proteintech is a Monoclonal antibody targeting Gastrokine 1 in WB, IHC, IF-P, ELISA applications with reactivity to human,  rat, pig, mouse samples\n60130-1-Ig targets Gastrokine 1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human,  rat, pig, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human stomach tissue,  rat stomach tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human stomach tissue, mouse stomach tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGastrokine 1 (GKN1), a stomach-speciﬁc protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1may play an important role in normal gastric function and may be a gastric tumour suppressor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6091 Product name: Recombinant human GKN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 35-196 aa of BC059778 Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN Predict reactive species\nFull Name: gastrokine 1\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC059778\nGene Symbol: Gastrokine 1\nGene ID (NCBI): 56287\nRRID: AB_2111459\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NS71\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888278950057,"sku":"60130-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60130-1-ig","provider":"Iright","version":"1.0","type":"link"}