{"product_id":"proteintech-60154-1-ig","title":"Proteintech, 60154-1-Ig, SMN (Human-Specific) Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMN (Human-Specific) (60154-1-Ig) by Proteintech is a Monoclonal antibody targeting SMN (Human-Specific) in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n60154-1-Ig targets SMN (Human-Specific) in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, Raji cells,  HepG2 cells,  HEK-293 cells,  Jurkat cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: mouse kidney tissue, human colon  cancer,  human heart tissue,  human kidney tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe survival of motor neurons (SMN) genes are the disease genes of spinal muscular atrophy (SMA), a common motor neuron degenerative disease. The level of SMN protein correlates with phenotypic severity of SMA. SMA patients lack a functional SMN1 gene, but they possess an intact SMN2 gene, which though nearly identical to SMN1, is only partially functional, because a large majority of SMN2 transcripts lack exon 7, resulting in production of a truncated, less stable SMN protein. This antibody 60154-1-Ig is specific to human SMN2. It can't recognize mouse and rat SMN.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14333 Product name: Recombinant human SMN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-282 aa of BC000908 Sequence: MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA Predict reactive species\nFull Name: survival of motor neuron 2, centromeric\nCalculated Molecular Weight: 282 aa, 30 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC000908\nGene Symbol: SMN\nGene ID (NCBI): 6607\nRRID: AB_10639513\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q16637\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888050000041,"sku":"60154-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60154-1-ig","provider":"Iright","version":"1.0","type":"link"}