{"product_id":"proteintech-60193-1-ig","title":"Proteintech, 60193-1-Ig, PPARD Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPARD (60193-1-Ig) by Proteintech is a Monoclonal antibody targeting PPARD in WB, ELISA applications with reactivity to human, pig samples\n60193-1-Ig targets PPARD in WB, IHC, ChIP, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  pig adipose tissue,  Jurkat cells,  K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPeroxisome proliferator-activator receptor delta(PPARD), a ligand-activated transcription factor, belongs to the PPARs family, which get its name for their chemicals \nthat induce proliferation of peroxisomes, organelles that contributes to the oxidation of fatty acids. PPARD is a receptor for peroxisome proliferator and once \n\nactivated by a ligand, it binds to and activates the promoter elements of target genes, such as acylCoA oxidase gene. But it act as a repressor for the NPC1L1 gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16770 Product name: Recombinant human PPARD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 102-361 aa of BC002715 Sequence: IRMKLEYEKCERSCKIQKKNRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGGE Predict reactive species\nFull Name: peroxisome proliferator-activated receptor delta\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 54 kDa\nGenBank Accession Number: BC002715\nGene Symbol: PPARD\nGene ID (NCBI): 5467\nRRID: AB_10896827\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q03181\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887990591657,"sku":"60193-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60193-1-ig","provider":"Iright","version":"1.0","type":"link"}