{"product_id":"proteintech-60194-1-ig","title":"Proteintech, 60194-1-Ig, CD3 Delta Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD3 Delta (60194-1-Ig) by Proteintech is a Monoclonal antibody targeting CD3 Delta in WB, ELISA applications with reactivity to human, mouse samples\n60194-1-Ig targets CD3 Delta in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD3 is a complex of proteins that directly associates with the T cell receptor (TCR). The TCR\/CD3 complex of T-lymphocytes consists of either a TCR alpha\/beta or TCR gamma\/delta heterodimer coexpressed at the cell surface with the invariant subunits of CD3 labeled gamma, delta, epsilon, zeta, and eta. The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction. CD3 is considered to be a pan-T cell marker for detection of normal and neoplastic T cells. CD3 delta\/CD3D is a single-pass type I membrane protein which consists of an extracellular domain of 84 amino acids, a transmembrane region, and a cytoplasmic domain of 45 amino acids. Defects in CD3 delta are a cause of severe combined immunodeficiency.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10207 Product name: Recombinant human CD3D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-171 aa of BC070321 Sequence: FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK Predict reactive species\nFull Name: CD3d molecule, delta (CD3-TCR complex)\nCalculated Molecular Weight: 171 aa, 19 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC070321\nGene Symbol: CD3 Delta\nGene ID (NCBI): 915\nRRID: AB_10898175\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P04234\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888105902249,"sku":"60194-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60194-1-ig","provider":"Iright","version":"1.0","type":"link"}