{"product_id":"proteintech-60195-1-ig","title":"Proteintech, 60195-1-Ig, TMEM70 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM70 (60195-1-Ig) by Proteintech is a Monoclonal antibody targeting TMEM70 in WB, IHC, ELISA applications with reactivity to human samples\n60195-1-Ig targets TMEM70 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, HeLa cells\nPositive IHC detected in: human liver tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM70 belongs to the TMEM70 family. It is involved in biogenesis of mitochondrial ATP synthase. Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD). A publication (PMID:21147908) identified TMEM70 gene defect as a pan-ethnic disorder and further redefined it as the most common cause of nuclear-origin ATP synthase deficiency.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16947 Product name: Recombinant human TMEM70 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 148-260 aa of BC002748 Sequence: MGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK Predict reactive species\nFull Name: transmembrane protein 70\nCalculated Molecular Weight: 260 aa, 29 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC002748\nGene Symbol: TMEM70\nGene ID (NCBI): 54968\nRRID: AB_10896316\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BUB7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888078278825,"sku":"60195-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60195-1-ig","provider":"Iright","version":"1.0","type":"link"}