{"product_id":"proteintech-60196-1-ig","title":"Proteintech, 60196-1-Ig, Fas\/CD95 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Fas\/CD95 (60196-1-Ig) by Proteintech is a Monoclonal antibody targeting Fas\/CD95 in WB, IHC, ELISA applications with reactivity to human samples\n60196-1-Ig targets Fas\/CD95 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HeLa cells,  K-562 cells,  U-937 cells\nPositive IHC detected in: human tonsillitis tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAS, also named as CD95, APO-1, APT1, FAS1 and TNFRSF6, is a receptor for TNFSF6\/FASLG. It is a cell surface receptor belonging to the TNF receptor superfamily, can mediate apoptosis by ligation with an agonistic anti-Fas antibody or Fas ligand. Stimulation of Fas results in the aggregation of its intracellular death domains, leading to the formation of the death-inducing signaling complex (DISC). FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). This anti-Fas monoclonal antibody can be used to induce apoptosis in cell cultures through Fas by imitating the Fas-ligand.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, zebrafish\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3718 Product name: Recombinant human FAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 156-335 aa of BC012479 Sequence: ECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV Predict reactive species\nFull Name: Fas (TNF receptor superfamily, member 6)\nCalculated Molecular Weight: 35-38 kDa\nObserved Molecular Weight: 38-45 kDa\nGenBank Accession Number: BC012479\nGene Symbol: Fas\/CD95\nGene ID (NCBI): 355\nRRID: AB_10892669\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P25445\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888338456745,"sku":"60196-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60196-1-ig","provider":"Iright","version":"1.0","type":"link"}