{"product_id":"proteintech-60208-1-ig","title":"Proteintech, 60208-1-Ig, CD23 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD23 (60208-1-Ig) by Proteintech is a Monoclonal antibody targeting CD23 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples\n60208-1-Ig targets CD23 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, DC2.4 cells,  U-937 cells,  Raji cells,  Ramos cells,  Daudi cells,  Mo7e cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD23, also known as low affinity immunoglobulin epsilon Fc receptor, is a transmembrane glycoprotein present on a subpopulation of B lymphocytes in germinal centres, EBV-transformed B-lymphoblastoid cell lines, follicular dendritic cells, and a subpopulation of peripheral blood cells. CD23 has essential roles in the regulation of IgE production and in the differentiation of B-cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0425 Product name: Recombinant human CD23,FCER2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 48-248 aa of BC064417 Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG Predict reactive species\nFull Name: Fc fragment of IgE, low affinity II, receptor for (CD23)\nCalculated Molecular Weight: 321 aa, 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC064417\nGene Symbol: CD23\nGene ID (NCBI): 2208\nRRID: AB_10949195\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P06734\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888014610601,"sku":"60208-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60208-1-ig","provider":"Iright","version":"1.0","type":"link"}