{"product_id":"proteintech-60222-1-ig","title":"Proteintech, 60222-1-Ig, SMMHC Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMMHC (60222-1-Ig) by Proteintech is a Monoclonal antibody targeting SMMHC in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n60222-1-Ig targets SMMHC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rabbit stomach tissue, human ileum tissue,  rat rectum tissue,  HeLa cells,  rabbit large intestine,  pig stomach,  pig rectum,  rat colon,  mouse colon\nPositive IHC detected in: human breast hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13397 Product name: Recombinant human MYH11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC101677 Sequence: MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLRERYFSGLIYTYSGLFCVVVNPYKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVS Predict reactive species\nFull Name: myosin, heavy chain 11, smooth muscle\nCalculated Molecular Weight: 1938 aa, 224 kDa\nObserved Molecular Weight: 220 kDa\nGenBank Accession Number: BC101677\nGene Symbol: SMMHC\/MYH11\nGene ID (NCBI): 4629\nRRID: AB_11182594\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P35749\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887997014185,"sku":"60222-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60222-1-ig","provider":"Iright","version":"1.0","type":"link"}