{"product_id":"proteintech-60231-1-ig","title":"Proteintech, 60231-1-Ig, FAF1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAF1 (60231-1-Ig) by Proteintech is a Monoclonal antibody targeting FAF1 in WB, ELISA applications with reactivity to human,  mouse,   rat samples\n60231-1-Ig targets FAF1 in WB, IF, ELISA applications and shows reactivity with human,  mouse,   rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAF1 was detected most abundant in testis, slightly less abundant in skeletal muscle and heart, followed by prostate, thymus, ovary, small intestine, and colon, but not in the peripheral blood leukocytes.The N-terminal region (amino acid 1∼201) including the upstream ubiquitin homology domain of hFAF1 could bind with the death domain of Fas, which mediates programmed cell death, also called apoptosis, in a number of organ systems, notably the immune and nervous systems.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0407 Product name: Recombinant human FAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-489 aa of BC004970 Sequence: RSSPAQTREQSEEQITDVHMVSDSDGDDFEDATEFGVDDGEVFGMASSALRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTA Predict reactive species\nFull Name: Fas (TNFRSF6) associated factor 1\nCalculated Molecular Weight: 650aa, 74 kDa\nObserved Molecular Weight: 74 kDa\nGenBank Accession Number: BC004970\nGene Symbol: FAF1\nGene ID (NCBI): 11124\nRRID: AB_11232212\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9UNN5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888041480361,"sku":"60231-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60231-1-ig","provider":"Iright","version":"1.0","type":"link"}