{"product_id":"proteintech-60249-1-ig","title":"Proteintech, 60249-1-Ig, PGRMC2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGRMC2 (60249-1-Ig) by Proteintech is a Monoclonal antibody targeting PGRMC2 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, pig samples\n60249-1-Ig targets PGRMC2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCaP cells,  HeLa cells,  MCF-7 cells,  MDA-MB-231 cells,  HepG2 cells,  pig liver tissue\nPositive IHC detected in: human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human cervical cancer tissue\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMembrane-associated progesterone receptor component 2 (PGRMC2), also known as DG6 or PMBP, belongs to the cytochrome b5 family. This protein might play a role in cancer. The gene of PGRMC2 maps to chromosome 4q26, and encodes a 223-amino acid single-pass membrane protein with a cytochrome b5 heme-binding domain in its cytoplasmic domain. PGRMC2 has a calculated molecular weight of 24 kDa. The band of about 28 kDa detected by this monoclonal antibody is unknown but may represent phosphorylated form of PGRMC2 (PMID: 28104494).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20077 Product name: Recombinant human PGRMC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 55-145 aa of BC016692 Sequence: LLNVALVALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRILLAVNGKVFDVTKGSKFYGPAGPYGI Predict reactive species\nFull Name: progesterone receptor membrane component 2\nCalculated Molecular Weight: 223 aa, 24 kDa\nObserved Molecular Weight: 24 kDa, 28 kDa\nGenBank Accession Number: BC016692\nGene Symbol: PGRMC2\nGene ID (NCBI): 10424\nRRID: AB_2881370\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15173\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888022573225,"sku":"60249-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60249-1-ig","provider":"Iright","version":"1.0","type":"link"}