{"product_id":"proteintech-60258-1-ig","title":"Proteintech, 60258-1-Ig, CD11c Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD11c (60258-1-Ig) by Proteintech is a Monoclonal antibody targeting CD11c in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n60258-1-Ig targets CD11c in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human spleen tissue, THP-1 cells,  HL-60 cells,  U-937 cells\nPositive IHC detected in: human tonsillitis tissue, human lung cancer tissue,  human breast cancer tissue,  human liver cancer tissue,  human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue, human appendicitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:10000-1:40000\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIntegrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. CD11c\/Integrin alpha X is a 145-150 kDa type I transmembrane glycoprotein present on a variety of cells, including monocytes\/macrophages, granulocytes, NK cells and dendritic cells. Integrin alpha X\/beta 2 acts a receptor for fibrinogen and is important in monocyte adhesion and chemotaxis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11350 Product name: Recombinant human CD11c\/Integrin alpha X protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-352 aa of BC038237 Sequence: NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA Predict reactive species\nFull Name: integrin, alpha X (complement component 3 receptor 4 subunit)\nCalculated Molecular Weight: 1169 aa, 129 kDa\nObserved Molecular Weight: 145 kDa\nGenBank Accession Number: BC038237\nGene Symbol: CD11c\nGene ID (NCBI): 3687\nENSEMBL Gene ID: ENSG00000140678\nRRID: AB_2881379\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P20702\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887983415465,"sku":"60258-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60258-1-ig","provider":"Iright","version":"1.0","type":"link"}