{"product_id":"proteintech-60269-1-ig","title":"Proteintech, 60269-1-Ig, IL-10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-10 (60269-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-10 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n60269-1-Ig targets IL-10 in WB, IHC, IF\/ICC, ELISA, Cell treatment applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: ag14870\nPositive IF\/ICC detected in: MOLT-4 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin (IL)-10 is an anti-inflammatory cytokine, produced by T helper (Th) cells, macrophages, monocytes, and B cells, that plays a crucial role in preventing inflammatory and autoimmune pathologies. It downregulates the expression of Th1 cytokines, MHC class II antigens, and co-stimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. IL-10 can block NF-κB activity, and is involved in the regulation of the JAK-STAT signaling pathway. IL-10, along with its receptors, describes an important role in pathogenesis of various diseases, including infectious, inflammatory, autoimmune diseases. IL-10 mutations are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat, rabbit, zebrafish\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag14870 Product name: Recombinant human IL-10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 19-178 aa of BC104252 Sequence: SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN Predict reactive species\nFull Name: interleukin 10\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC104252\nGene Symbol: IL-10\nGene ID (NCBI): 3586\nRRID: AB_2881389\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P22301\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887970930857,"sku":"60269-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60269-1-ig","provider":"Iright","version":"1.0","type":"link"}