{"product_id":"proteintech-60286-1-ig","title":"Proteintech, 60286-1-Ig, PRDX4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRDX4 (60286-1-Ig) by Proteintech is a Monoclonal antibody targeting PRDX4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n60286-1-Ig targets PRDX4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, NIH\/3T3 cells,  HeLa cells,  HepG2 cells,  K-562 cells,  PC-12 cells,  HEK-293 cells,  Jurkat cells,  HSC-T6 cells\nPositive IHC detected in: human colon tissue,  human pancreas cancer tissue,  human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRDX4(Peroxiredoxin-4) is also named as AOE37-2, Prx-IV and belongs to the AhpC\/TSA family. PRDX4 is associated with acrosome formation during rat spermatogenesis and has a protective role in the male reproductive tract, because the phenotype of mice lacking this isoform includes testicular atrophy and increased sperm DNA damage(PMID:20864641). It is initially synthesized as a membrane-binding 31-kDa protein and processed into a 27-kDa secretory form and is discarded with the residual bodies(PMID:19208552). PRDX4 is a pentamer of dimers(PMID:23025503).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13401 Product name: Recombinant human PRDX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-271 aa of BC007107 Sequence: MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN Predict reactive species\nFull Name: peroxiredoxin 4\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC007107\nGene Symbol: PRDX4\nGene ID (NCBI): 10549\nRRID: AB_2881403\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13162\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888032207017,"sku":"60286-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60286-1-ig","provider":"Iright","version":"1.0","type":"link"}