{"product_id":"proteintech-60301-1-ig","title":"Proteintech, 60301-1-Ig, BID Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BID (60301-1-Ig) by Proteintech is a Monoclonal antibody targeting BID in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n60301-1-Ig targets BID in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:200-1:1800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBID, also named as p22 BID, can be cleaved into p11 BID, p13 BID and p15 BID. It is pro-apoptotic molecules. The major proteolytic product p15 BID allows the release of cytochrome c. BID-L, BID-EL and BID-ES induce ICE-like proteases and apoptosis. BID-S does not induce apoptosis. BID counters the protective effect of Bcl-2. (PMID:14583606).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21005 Product name: Recombinant human BID protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-195 aa of BC009197 Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD Predict reactive species\nFull Name: BH3 interacting domain death agonist\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC009197\nGene Symbol: BID\nGene ID (NCBI): 637\nRRID: AB_2881416\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P55957\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888102887593,"sku":"60301-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60301-1-ig","provider":"Iright","version":"1.0","type":"link"}