{"product_id":"proteintech-60311-1-ig","title":"Proteintech, 60311-1-Ig, HER2\/ErbB2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe HER2\/ErbB2 (60311-1-Ig) by Proteintech is a Monoclonal antibody targeting HER2\/ErbB2 in IHC, IF-P, ELISA applications with reactivity to human samples\n60311-1-Ig targets HER2\/ErbB2 in IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue\nPositive FC detected in: SK-BR-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:800-1:3200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nFlow Cytometry (FC): FC : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHER2, ErbB2, and Neu is a 185-kDa transmembrane glycoprotein member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. It has no ligand-binding domain and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Amplification and\/or overexpression of HER2 have been reported in numerous cancers, including \nbreast and ovarian tumors. HER2 is a therapeutic target for the treatment of breast cancer and other carcinomas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16463 Product name: Recombinant human ERBB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-372 aa of BC156755 Sequence: TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFG Predict reactive species\nFull Name: v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro\/glioblastoma derived oncogene homolog (avian)\nCalculated Molecular Weight: 1255 aa, 138 kDa\nGenBank Accession Number: BC156755\nGene Symbol: HER2\/ErbB2\nGene ID (NCBI): 2064\nRRID: AB_2881423\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04626\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888003403945,"sku":"60311-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60311-1-ig","provider":"Iright","version":"1.0","type":"link"}