{"product_id":"proteintech-60320-1-ig","title":"Proteintech, 60320-1-Ig, Cytokeratin 14 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 14 (60320-1-Ig) by Proteintech is a Monoclonal antibody targeting Cytokeratin 14 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n60320-1-Ig targets Cytokeratin 14 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse skin tissue\nPositive IHC detected in: human lung cancer tissue, human cervical cancer tissue,  human skin tissue,  human breast hyperplasia tissue,  human skin cancer tissue,  rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skin tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:400-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKeratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 14 is a type I cytokeratin. It is usually found as a heterotetramer with keratin 5. Keratins K14 and K5 have long been considered to be biochemical markers of the stratified squamous epithelia, including epidermis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17559 Product name: Recombinant human KRT14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 426-472 aa of BC002690 Sequence: LSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN Predict reactive species\nFull Name: keratin 14\nCalculated Molecular Weight: 472 aa, 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC002690\nGene Symbol: Cytokeratin 14\nGene ID (NCBI): 3861\nRRID: AB_2881431\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P02533\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887984693417,"sku":"60320-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60320-1-ig","provider":"Iright","version":"1.0","type":"link"}