{"product_id":"proteintech-60414-1-ig","title":"Proteintech, 60414-1-Ig, LMOD1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LMOD1 (60414-1-Ig) by Proteintech is a Monoclonal antibody targeting LMOD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n60414-1-Ig targets LMOD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig colon tissue, ARPE-19 cells,  hTERT-RPE1 cells,  rabbit colon tissue,  rat colon tissue,  mouse colon tissue,  rabbit testis tissue,  rat uterus tissue,  mouse uterus tissue\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLMOD1 was initially identified as a 64-kDa autoantigen in an expression screen with sera from patients with Hashimoto's thyroiditis. Recently immunohistochemistry and immunoblotting of LMOD1 demonstrated its highly restrictive pattern of expression in SMC lineages,like adult aorta, and bladder. LMOD1 is also shown to exhibit an embryonic and adult expression pattern. These data identify LMOD1 as a new SMC-restricted gene associated with the SMC differentiated phenotype.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7568 Product name: Recombinant human LMOD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-269 aa of BC001755 Sequence: MEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ Predict reactive species\nFull Name: leiomodin 1 (smooth muscle)\nCalculated Molecular Weight: 67 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC001755\nGene Symbol: LMOD1\nGene ID (NCBI): 25802\nRRID: AB_3670257\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P29536\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888290255017,"sku":"60414-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60414-1-ig","provider":"Iright","version":"1.0","type":"link"}