{"product_id":"proteintech-60966-4-ig","title":"Proteintech, 60966-4-Ig, FHL3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FHL3 (60966-4-Ig) by Proteintech is a Monoclonal antibody targeting FHL3 in WB, ELISA applications with reactivity to human, rat, pig samples\n60966-4-Ig targets FHL3 in WB, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, Mo7e cells,  pig skeletal muscle tissue,  HeLa cells,  K-562 cells,  Kasumi-1 cells,  rat skeletal muscle tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFour and a half LIM domain (FHL) protein 3 is a member of the FHL protein family that has roles in the regulation of signal transduction, survival, cell adhesion, and mobility. It also involves in the development and progression of liver cancer. The FHL proteins have been shown to regulate a variety of transcription factors, including SMAD proteins, β-catenin, SRF, AP-1, NFAT, FOXO1, MyoD, and the androgen receptor. Beside, the FHL proteins may involve in muscle growth and differentiation. Recent research revealed FHL3 was a PCBP2 target, also involved in the growth and induced apoptosis of glioma cell (23585479).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1495 Product name: Recombinant human FHL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC011697 Sequence: MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP Predict reactive species\nFull Name: four and a half LIM domains 3\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 30-34 kDa\nGenBank Accession Number: BC011697\nGene Symbol: FHL3\nGene ID (NCBI): 2275\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q13643\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888277115049,"sku":"60966-4-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-60966-4-ig","provider":"Iright","version":"1.0","type":"link"}