{"product_id":"proteintech-61022-1-ig","title":"Proteintech, 61022-1-Ig, PURB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PURB (61022-1-Ig) by Proteintech is a Monoclonal antibody targeting PURB in WB, IHC, ELISA applications with reactivity to human, mouse, rat, rabbit samples\n61022-1-Ig targets PURB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, LNCap cells,  HeLa cells,  HepG2 cells,  K-562 cells,  HSC-T6 cells,  C2C12 cells,  pig brain tissue,  rabbit brain tissue\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPURB (Purine-rich element-binding protein B) is a ubiquitously expressed DNA\/RNA-binding protein. It localizes to both the nucleus and cytoplasm, reflecting its dual role in transcriptional regulation and RNA metabolism. Its primary function is to bind purine-rich sequences to control gene expression, cell cycle progression, and differentiation. The observed molecular weight of PURB by SDS-PAGE is  33-40 kDa, which is close to its predicted molecular weight of ~33 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12816 Product name: Recombinant human PURB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-312 aa of BC101735 Sequence: MADGDSGSERGGGGGPCGFQPASRGGGEQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSMAVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRENRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQGLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITVDSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYADEMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED Predict reactive species\nFull Name: purine-rich element binding protein B\nCalculated Molecular Weight: 312 aa, 33 kDa\nObserved Molecular Weight: 33-40 kDa\nGenBank Accession Number: BC101735\nGene Symbol: PURB\nGene ID (NCBI): 5814\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96QR8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888316108969,"sku":"61022-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-61022-1-ig","provider":"Iright","version":"1.0","type":"link"}