{"product_id":"proteintech-61038-2-ig","title":"Proteintech, 61038-2-Ig, Alpha-1-microglobulin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha-1-microglobulin (61038-2-Ig) by Proteintech is a Monoclonal antibody targeting Alpha-1-microglobulin in WB, IF\/ICC, ELISA applications with reactivity to human samples\n61038-2-Ig targets Alpha-1-microglobulin in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, PNGF treated HepG2 cells,  human urine,  and PNGF-treated human urine.\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:817-1:3268\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha-1-microglobulin (A1M) is also named as Protein AMBP, Bikunin, Trypstatin and Inter-alpha-trypsin inhibitor light chain (ITI-LC). A1M belongs to the lipocalin protein family,  a group of structural proteins with a similar one-domain fold that are found in bacteria, plants and animals (PMID: 2580349). A1M is recognized as a physiological antioxidant with powerful cell- and tissue-protective properties (PMID: 11877257). Whereas A1M is a heme and radical scavenger, and a reductase, bikunin is a structural component of extracellular matrix and has protease inhibitor and anti-inflammatory properties (PMID: 27988357). In humans, the majority of A1M is synthesized in the liver,  but smaller quantities are also expressed in most other cells in the body. In the blood,  equal quantities of two forms of A1M can be found:  a free monomeric form and a covalent high-molecular weight complex bound to immunoglobulin A, albumin and prothrombin (PMID: 6196366, PMID: 9183005). Endogenous A1M has also been described to be localized ubiquitously in the dermal and epidermal layers of skin, and in syncytiothrophoblasts, monocytes\/macrophages, vascular endothelium and extracellular matrix of placental tissue and extracellular matrix (PMID: 22096585,PMID: 21356557). Alpha 1 microglobulin, also known as HI30, is a 27-30 kDa glycoprotein, present in various body fluids. It belongs to the lipocalin superfamily of hydrophobic ligand-binding proteins forming an internal ligand-binding pocket. The protein acts as a mediator of bacterial adhesion to polymer surfaces and is involved in inhibiting renal lithogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag37772 Product name: Recombinant human AMBP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-352 aa of BC041593 Sequence: AVLPQEEEGSGGGQLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN Predict reactive species\nFull Name: alpha-1-microglobulin\/bikunin precursor\nCalculated Molecular Weight: 352 aa, 39 kDa\nObserved Molecular Weight: 30-39 kDa\nGenBank Accession Number: BC041593\nGene Symbol: Alpha 1 microglobulin\nGene ID (NCBI): 259\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02760\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888086798505,"sku":"61038-2-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-61038-2-ig","provider":"Iright","version":"1.0","type":"link"}