{"product_id":"proteintech-66030-1-ig","title":"Proteintech, 66030-1-Ig, Serpin A5\/Protein C Inhibitor Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Serpin A5\/Protein C Inhibitor (66030-1-Ig) by Proteintech is a Monoclonal antibody targeting Serpin A5\/Protein C Inhibitor in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n66030-1-Ig targets Serpin A5\/Protein C Inhibitor in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Human testis,   tissue\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human ovary tumor tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSERPINA5 (also called Protein C Inhibitor, PCI ) is a serpin type of serine protease inhibitor that is found in many tissues and fluids in human, including blood plasma, seminal plasma and urine. PCI found in blood originates from the liver and is capable of inhibiting several serine proteases involved in the regulation of coagulation and fibrinolysis, including activated protein C, thrombin, factor Xa, various kallikreins and plasminogen activators. PCI has been found to have antimicrobial and antitumor properties and thus appears to be a multi-functional protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18094 Product name: Recombinant human SERPINA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 106-406 aa of BC008915 Sequence: ELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVAKQTKGKIVDLLKNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVFNRPFLMFIVDNNILFLGKVNRP Predict reactive species\nFull Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 46 kDa\nGenBank Accession Number: BC008915\nGene Symbol: SERPINA5\nGene ID (NCBI): 5104\nRRID: AB_11045661\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P05154\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888322760873,"sku":"66030-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66030-1-ig","provider":"Iright","version":"1.0","type":"link"}