{"product_id":"proteintech-66053-1-ig","title":"Proteintech, 66053-1-Ig, NDUFS5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDUFS5 (66053-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFS5 in WB, IHC, ELISA applications with reactivity to human samples\n66053-1-Ig targets NDUFS5 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, L02 cells,  HEK-293 cells,  fetal human brain tissue\nPositive IHC detected in: human kidney tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDUFS5 gene is a member of the NADH dehydrogenase (ubiquinone) iron-sulfur protein family. The encoded protein is a subunit of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. The NDUFS5 mRNA is expressed ubiquitously in human tissues, with a relative higher expression in human heart, skeletal muscle, liver, kidney and fetal heart (PMID: 10070614). The NDUFS5 (15 kDa) subunit located at mitochondrion and contains two C-X9-C motifs that are predicted to form a helix-coil-helix structure, permitting the formation of intramolecular disulfide bonds (PMID: 21310150). Proteinteach's NDUFS5 antibody 66053-1-Ig is capable of detecting the 15 kDa protein in Western blotting.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7663 Product name: Recombinant human NDUFS5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-106 aa of BC001884 Sequence: MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP Predict reactive species\nFull Name: NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase)\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC001884\nGene Symbol: NDUFS5\nGene ID (NCBI): 4725\nRRID: AB_11043342\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O43920\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888302379177,"sku":"66053-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66053-1-ig","provider":"Iright","version":"1.0","type":"link"}