{"product_id":"proteintech-66054-1-ig","title":"Proteintech, 66054-1-Ig, ARHGDIB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARHGDIB (66054-1-Ig) by Proteintech is a Monoclonal antibody targeting ARHGDIB in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n66054-1-Ig targets ARHGDIB in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, Jurkat cells,  U-937 cells,  HL-60 cells,  Raji cells\nPositive IHC detected in: human tonsillitis tissue, human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:10000-1:50000\nImmunohistochemistry (IHC): IHC : 1:5000-1:10000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARHGDIB, also known as RhoGDI2, is a conserved member of the RhoGDI family and plays an important role in cell migrations. It regulates the GDP\/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. It is mainly in hematopoietic, endothelial, and epithelial cells. It has been linked to tumorigenesis and metastasis. RhoGDI2 expression is downregulated in several cancer types, such as bladder, lung and lymphoma, but is upregulated in prostate and gastric cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9091 Product name: Recombinant human ARHGDIB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC009200 Sequence: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE Predict reactive species\nFull Name: Rho GDP dissociation inhibitor (GDI) beta\nCalculated Molecular Weight: 201 aa, 23 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC009200\nGene Symbol: ARHGDIB\nGene ID (NCBI): 397\nRRID: AB_11045657\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P52566\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888056029353,"sku":"66054-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66054-1-ig","provider":"Iright","version":"1.0","type":"link"}