{"product_id":"proteintech-66057-1-ig","title":"Proteintech, 66057-1-Ig, Cofilin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cofilin (66057-1-Ig) by Proteintech is a Monoclonal antibody targeting Cofilin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n66057-1-Ig targets Cofilin in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, HeLa cells,  HEK-293 cells,  Jurkat cells,  K-562 cells,  pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue,  SH-SY5Y cells,  A431 cells,  PC-12 cells,  Neuro-2a cells\nPositive IHC detected in: human testis tissue, human lung cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)\/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation. Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18044 Product name: Recombinant human Cofilin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-166 aa of BC012318 Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL Predict reactive species\nFull Name: cofilin 1 (non-muscle)\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC012318\nGene Symbol: Cofilin\nGene ID (NCBI): 1072\nRRID: AB_11043339\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P23528\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887984660649,"sku":"66057-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66057-1-ig","provider":"Iright","version":"1.0","type":"link"}