{"product_id":"proteintech-66074-1-ig","title":"Proteintech, 66074-1-Ig, APOH Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe APOH (66074-1-Ig) by Proteintech is a Monoclonal antibody targeting APOH in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n66074-1-Ig targets APOH in WB, IHC, IF\/ICC, IF-P, Neutralization, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma, human testis tissue,  pig plasma,  human heart tissue,  pig heart tissue,  rabbit heart tissue,  rat heart tissue,  mouse heart tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:100-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApolipoprotein H (ApoH), also known as beta2-glycoprotein I (B2-GPI), is a plasma glycoprotein, primarily synthesized in the liver. It has an important function in blood coagulation and clearance of apoptotic bodies from the circulation. ApoH is also an important actor of host innate immune response through its capacity to bind with high affinity to a large panel of pathogens or their proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17915 Product name: Recombinant human APOH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-345 aa of BC026283 Sequence: RTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC Predict reactive species\nFull Name: apolipoprotein H (beta-2-glycoprotein I)\nCalculated Molecular Weight: 345 aa, 38 kDa\nObserved Molecular Weight: 50-53 kDa\nGenBank Accession Number: BC026283\nGene Symbol: APOH\nGene ID (NCBI): 350\nRRID: AB_11182392\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P02749\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888013955241,"sku":"66074-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66074-1-ig","provider":"Iright","version":"1.0","type":"link"}