{"product_id":"proteintech-66087-1-ig","title":"Proteintech, 66087-1-Ig, UBE2C Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE2C (66087-1-Ig) by Proteintech is a Monoclonal antibody targeting UBE2C in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66087-1-Ig targets UBE2C in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  HepG2 cells,  U2OS cells,  A549 cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human lung cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBE2C(Ubiquitin-conjugating enzyme E2 C) is also known as UBCH10 and belongs to the ubiquitin-conjugating enzyme family. It is highly expressed in a variety of human primary tumors, and it is able to promote cell proliferation and malignant transformation(PMID:18703417). UBE2C, along with the E3 ligase of the anaphasepromoting complex (APC), catalyzes the ubiquitination of mitotic cyclins A and B, as well as securin. UBE2C is essential for cell cycle progression, and mutation of its active site cysteine confers a dominant-negative phenotype(PMID:17217624).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19235 Product name: Recombinant human UBE2C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-179 aa of BC016292 Sequence: MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2C\nCalculated Molecular Weight: 179 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC016292\nGene Symbol: UBE2C\nGene ID (NCBI): 11065\nRRID: AB_11232220\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O00762\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887992197289,"sku":"66087-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66087-1-ig","provider":"Iright","version":"1.0","type":"link"}