{"product_id":"proteintech-66142-1-ig","title":"Proteintech, 66142-1-Ig, IL-4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-4 (66142-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-4 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, pig samples\n66142-1-Ig targets IL-4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue\nPositive FC (Intra) detected in: Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, mouse, rat, pig, bovine\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9940 Product name: Recombinant human IL-4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-153 aa of BC070123 Sequence: GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS Predict reactive species\nFull Name: interleukin 4\nCalculated Molecular Weight: 153 aa, 17 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC070123\nGene Symbol: IL-4\nGene ID (NCBI): 3565\nRRID: AB_2881539\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P05112\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887977681065,"sku":"66142-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66142-1-ig","provider":"Iright","version":"1.0","type":"link"}