{"product_id":"proteintech-66148-1-ig","title":"Proteintech, 66148-1-Ig, IL-17A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-17A (66148-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-17A in WB, IF-P, ELISA applications with reactivity to human, mouse samples\n66148-1-Ig targets IL-17A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Jurkat cells,  Raji cells,  U-937 cells,  MOLT-4 cells,  Ramos cells,  Daudi cells,  HL-60 cells,  RAW 264.7 cells\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2\/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3733 Product name: Recombinant human IL-17A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC067505 Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA Predict reactive species\nFull Name: interleukin 17A\nCalculated Molecular Weight: 155 aa, 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC067505\nGene Symbol: IL-17A\nGene ID (NCBI): 3605\nENSEMBL Gene ID: ENSG00000112115\nRRID: AB_2881544\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q16552\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887981220009,"sku":"66148-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66148-1-ig","provider":"Iright","version":"1.0","type":"link"}