{"product_id":"proteintech-66154-1-ig","title":"Proteintech, 66154-1-Ig, Complement factor B Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Complement factor B (66154-1-Ig) by Proteintech is a Monoclonal antibody targeting Complement factor B in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n66154-1-Ig targets Complement factor B in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human blood tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nComplement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is cleaved into Ba and Bb by factor D in the presence of C3b. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19107 Product name: Recombinant human CFB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 574-762 aa of BC007990 Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG Predict reactive species\nFull Name: complement factor B\nCalculated Molecular Weight: 86 kDa\nObserved Molecular Weight: 93 kDa\nGenBank Accession Number: BC007990\nGene Symbol: Complement factor B\nGene ID (NCBI): 629\nRRID: AB_2881550\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Caprylic acid\/ammonium sulfate precipitation\nUNIPROT ID: P00751\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888110915753,"sku":"66154-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66154-1-ig","provider":"Iright","version":"1.0","type":"link"}