{"product_id":"proteintech-66167-1-ig","title":"Proteintech, 66167-1-Ig, Claudin 18 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Claudin 18 (66167-1-Ig) by Proteintech is a Monoclonal antibody targeting Claudin 18 in IHC, IP, ELISA applications with reactivity to human, mouse samples\n66167-1-Ig targets Claudin 18 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse stomach tissue\nPositive IHC detected in: human pancreas cancer tissue, human ovary tumor tissue,  human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClaudin 18 (CLDN18) belongs to the large claudin family of proteins, which are tetraspan transmembrane proteins of tight junctions (PMID: 11585919; 18036336). Claudins exhibit specific patterns of expression in different tissues (PMID: 15447685). CLDN18 is specifically expressed in the stomach and lung. CLDN18 has two alternatively spliced variants, CLDN18.1 and CLDN18.2. CLDN18.2 is a highly selective gastric lineage marker that determines the gastric phenotype in a neoplastic condition, whereas CLDN18.1 is lung specific (PMID: 11585919; 21832145). Altered CLDN18 expression has been reported in various human malignancies, including gastric cancer, lung adenocarcinoma, and pancreatic neoplasm (PMID: 17459057; 22076167; 21832145). This antibody can recognize both CLDN18.1 and CLDN18.2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15517 Product name: Recombinant human CLDN18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-261 aa of BC146668 Sequence: TLIGGVMMCIACRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV Predict reactive species\nFull Name: claudin 18\nCalculated Molecular Weight: 261 aa, 28 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC146668\nGene Symbol: CLDN18\nGene ID (NCBI): 51208\nRRID: AB_2881563\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P56856\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888014676137,"sku":"66167-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66167-1-ig","provider":"Iright","version":"1.0","type":"link"}