{"product_id":"proteintech-66186-1-ig","title":"Proteintech, 66186-1-Ig, Fibrinogen Beta Chain Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Fibrinogen Beta Chain (66186-1-Ig) by Proteintech is a Monoclonal antibody targeting Fibrinogen Beta Chain in WB, ELISA applications with reactivity to human samples\n66186-1-Ig targets Fibrinogen Beta Chain in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human heart tissue,  fetal human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFibrinogen is a soluble plasma glycoprotein synthesized in the liver. It is composed of two sets of three structurally different subunits: alpha (FGA), beta (FGB), gamma (FGG). Fibrinogen is converted by thrombin into fibrin during blood coagulation. Fibrinogen and fibrin play overlapping roles in blood clotting, fibrinolysis, cellular and matrix interactions, the inflammatory response, wound healing, and neoplasia (PMID: 16102057). FGB is the beta chain of fibrinogen. During conversion of fibrinogen to fibrin, fibrinopeptide B is cleaved from FGB by thrombin. Mutations in the gene of FGB lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag10205 Product name: Recombinant human FGB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 142-491 aa of BC107766 Sequence: SSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEITRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFPQQ Predict reactive species\nFull Name: fibrinogen beta chain\nCalculated Molecular Weight: 491 aa, 56 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC107766\nGene Symbol: Fibrinogen Beta Chain\nGene ID (NCBI): 2244\nRRID: AB_2881581\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02675\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888041676969,"sku":"66186-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66186-1-ig","provider":"Iright","version":"1.0","type":"link"}