{"product_id":"proteintech-66196-1-ig","title":"Proteintech, 66196-1-Ig, IL-23 p19 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-23 p19 (66196-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-23 p19 in IHC, ELISA applications with reactivity to human samples\n66196-1-Ig targets IL-23 p19 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human stomach cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin 23 (IL-23) is a member of the IL12 cytokine family and composed of two subunits, IL12p40 and IL23p19. It is produced by antigen presenting cells and has been shown to promote the production and survival of a distinct lineage of T-cells called TH17 cells. A functional receptor for IL-23 (the IL-23 receptor) has been identified and is composed of Il-12Rβ1 and IL-23R. IL-23 is expressed chiefly by the macrophages and DCs. The IL-23R is found on memory T cells, NKT cells, macrophages, DCs, and naive T cells upon activation by TGF-βand IL-6. The main biological effects of IL-23 identified initially consist of stimulation of antigen presentation by DCs, T cell differentiation to Th17 cells, and production of interferon-γ (IFN-γ). IL-23 acts also as an end-stage effector cytokine through direct action on macrophages.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19406 Product name: Recombinant human IL-23A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 17-189 aa of BC066268 Sequence: AQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP Predict reactive species\nFull Name: interleukin 23, alpha subunit p19\nCalculated Molecular Weight: 189 aa, 21 kDa\nGenBank Accession Number: BC066268\nGene Symbol: IL23A\nGene ID (NCBI): 51561\nRRID: AB_2881589\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9NPF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888011235497,"sku":"66196-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66196-1-ig","provider":"Iright","version":"1.0","type":"link"}