{"product_id":"proteintech-66205-1-ig","title":"Proteintech, 66205-1-Ig, Myoglobin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Myoglobin (66205-1-Ig) by Proteintech is a Monoclonal antibody targeting Myoglobin in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n66205-1-Ig targets Myoglobin in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human skeletal muscle tissue, pig heart tissue,  rat heart tissue,  mouse heart tissue,  rabbit heart tissue,  human heart tissue\nPositive IHC detected in: human heart tissue, mouse tongue tissue,  rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: C2C12 cells\nPositive FC (Intra) detected in: C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:80000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMyoglobin is a cytoplasmic hemoprotein that is expressed primarily in cardiomyocytes and oxidative skeletal muscle fibers, functioning on facilitating oxygen transport and modulating nitric oxide homeostasis within cardiac and skeletal myocytes. Recent studies indicated that myoglobin was also expressed in non-muscle tissues. This antibody well recognized endogenous myoglobin in muscle lysates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8979 Product name: Recombinant human MB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-154 aa of BC014547 Sequence: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Predict reactive species\nFull Name: myoglobin\nCalculated Molecular Weight: 154 aa, 17 kDa\nObserved Molecular Weight: 17-18 kDa\nGenBank Accession Number: BC014547\nGene Symbol: Myoglobin\nGene ID (NCBI): 4151\nRRID: AB_2881596\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P02144\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888068219049,"sku":"66205-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66205-1-ig","provider":"Iright","version":"1.0","type":"link"}