{"product_id":"proteintech-66245-1-ig","title":"Proteintech, 66245-1-Ig, Annexin V Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Annexin V (66245-1-Ig) by Proteintech is a Monoclonal antibody targeting Annexin V in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, pig samples\n66245-1-Ig targets Annexin V in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MG-63 cells, HEK-293 cells,  HeLa cells,  human urine exosomes tissue,  mouse brain tissue,  Raw 264.7 cells,  NIH\/3T3 cells,  K-562 cells,  HepG2 cells,  U-87 MG cells,  MDA-MB-231 cells,  pig brain tissue\nPositive IHC detected in: human malignant melanoma tissue,  human colon tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: NIH\/3T3 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAnnexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag1538 Product name: Recombinant human ANXA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-320 aa of BC001429 Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD Predict reactive species\nFull Name: annexin A5\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC001429\nGene Symbol: Annexin V\nGene ID (NCBI): 308\nRRID: AB_2881634\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P08758\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888053702825,"sku":"66245-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66245-1-ig","provider":"Iright","version":"1.0","type":"link"}