{"product_id":"proteintech-66250-1-ig","title":"Proteintech, 66250-1-Ig, C-Reactive Protein\/CRP Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe C-Reactive Protein\/CRP (66250-1-Ig) by Proteintech is a Monoclonal antibody targeting C-Reactive Protein\/CRP in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n66250-1-Ig targets C-Reactive Protein\/CRP in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: serum from mouse injected with bacteria, pig liver tissue,  rat liver tissue,  serum from mouse injected with bacteria tissue\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-reactive protein (CRP) is an acute-phase serum protein synthesized by the liver in response to interleukin-6 (IL-6) during inflammation. The name of CRP derives from its ability to react with the C polysaccharide of Streptococcus pneumoniae. CRP is an annular, pentameric protein that belongs to the pentraxin family of proteins. CRP displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. It is used mainly as a marker of inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, pig, monkey\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9883 Product name: Recombinant human CRP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-91 aa of BC020766 Sequence: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP Predict reactive species\nFull Name: C-reactive protein, pentraxin-related\nCalculated Molecular Weight: 224 aa, 25 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC020766\nGene Symbol: CRP\nGene ID (NCBI): 1401\nRRID: AB_2881638\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P02741\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887991574697,"sku":"66250-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66250-1-ig","provider":"Iright","version":"1.0","type":"link"}