{"product_id":"proteintech-66258-1-ig","title":"Proteintech, 66258-1-Ig, FAK Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAK (66258-1-Ig) by Proteintech is a Monoclonal antibody targeting FAK in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66258-1-Ig targets FAK in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: hTERT-RPE1 cells, human testis tissue,  MCF-7 cells,  HCT 116 cells,  NIH\/3T3 cells,  RAW 264.7 cells,  ROS1728 cells,  HepG2 cells,  HeLa cells,  Jurkat cells,  K-562 cells,  pig brain tissue,  rabbit brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HUVEC cells, A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms  produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2c\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17966 Product name: Recombinant human FAK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 381-678 aa of BC028733 Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR Predict reactive species\nFull Name: PTK2 protein tyrosine kinase 2\nCalculated Molecular Weight: 1052 aa, 119 kDa\nObserved Molecular Weight: 110 kDa\nGenBank Accession Number: BC028733\nGene Symbol: FAK\nGene ID (NCBI): 5747\nRRID: AB_2881646\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q05397\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887979319465,"sku":"66258-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66258-1-ig","provider":"Iright","version":"1.0","type":"link"}