{"product_id":"proteintech-66309-1-ig","title":"Proteintech, 66309-1-Ig, PEX5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PEX5 (66309-1-Ig) by Proteintech is a Monoclonal antibody targeting PEX5 in WB, IHC, ELISA applications with reactivity to human,  pig,  rat samples\n66309-1-Ig targets PEX5 in WB, IHC, ELISA applications and shows reactivity with human,  pig,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, HEK-293 cells,  fetal human brain tissue\nPositive IHC detected in: human liver tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe peroxisomal targeting signal type1 (PTS1) receptor, PEX5, is one member of peroxins (PEXs) which are proteins required for peroxisome assembly. PEX5 and PEX7 function as receptors that recognize PTS1- and PTS2- containing proteins, respectively, and PEX5 binds PTS1 through its C-terminal 40-kDa tetratricopeptide repeat domain. It is a predominantly cytoplasmic, partly peroxisomal protein that appears to shuttle between these compartments as it mediates the import of PTS1-containing proteins. PEX5 has been reported to interact with PEX10, PEX12, PEX13, and PEX14. Defects in PEX5 are a cause of Zellweger syndrome (ZWS), which is a lethal peroxisome biogenesis disorder.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3268 Product name: Recombinant human PEX5 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 340-639 aa of BC010621 Sequence: EGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ Predict reactive species\nFull Name: peroxisomal biogenesis factor 5\nCalculated Molecular Weight: 631 aa, 70 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC010621\nGene Symbol: PEX5\nGene ID (NCBI): 5830\nRRID: AB_2881691\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P50542\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888070709417,"sku":"66309-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66309-1-ig","provider":"Iright","version":"1.0","type":"link"}