{"product_id":"proteintech-66343-1-ig","title":"Proteintech, 66343-1-Ig, CLIC4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLIC4 (66343-1-Ig) by Proteintech is a Monoclonal antibody targeting CLIC4 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, rat, pig samples\n66343-1-Ig targets CLIC4 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, pig heart tissue,  HeLa cells,  U2Os cells,  pig kidney tissue,  rabbit kidney tissue,  rat kidney tissue,  mouse kidney tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human heart tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: BT-549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. CLIC4 is a p53- and tumor necrosis factor alpha-regulated cytoplasmic and mitochondrial protein that belongs to the CLIC family of intracellular chloride channels. CLICs have actions distinct from traditional cell membrane chloride channels, including formation of ion channels in intracellular organelles and roles in membrane trafficking, apoptosis, and cell differentiation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nCited Reactivity: rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2942 Product name: Recombinant human CLIC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-253 aa of BC012444 Sequence: MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK Predict reactive species\nFull Name: chloride intracellular channel 4\nCalculated Molecular Weight: 253 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC012444\nGene Symbol: CLIC4\nGene ID (NCBI): 25932\nRRID: AB_2881723\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9Y696\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888059338921,"sku":"66343-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66343-1-ig","provider":"Iright","version":"1.0","type":"link"}