{"product_id":"proteintech-66348-1-ig","title":"Proteintech, 66348-1-Ig, Dermatopontin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Dermatopontin (66348-1-Ig) by Proteintech is a Monoclonal antibody targeting Dermatopontin in WB, IF\/ICC, ELISA applications with reactivity to human,  rat samples\n66348-1-Ig targets Dermatopontin in WB, IF\/ICC, ELISA applications and shows reactivity with human,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat skin tissue,  human testis tissue\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDPT (dermatopontin) is an extracellular matrix protein belonging to the dermatopontin family. Skin appears to be the richest source of dermatopontin, comprising about 15 mg\/kg of the wet weight. Expression of dermatopontin is not limited to connective tissue, as investigations show that dermatopontin mRNA is expressed in cultured fibroblasts, muscle, heart, pancreas, and lung. Dermatopontin comprises a considerable proportion of the noncollagenous extracellular matrix proteins. It is involved in promotion of cellular adhesion, extracellular matrix assembly, wound healing, and positive modification of the inhibition activity of TGF-beta1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6200 Product name: Recombinant human DPT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-201 aa of BC033736 Sequence: MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV Predict reactive species\nFull Name: dermatopontin\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC033736\nGene Symbol: DPT\/TRAMP\nGene ID (NCBI): 1805\nRRID: AB_2881728\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q07507\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888060846249,"sku":"66348-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66348-1-ig","provider":"Iright","version":"1.0","type":"link"}