{"product_id":"proteintech-66350-1-ig","title":"Proteintech, 66350-1-Ig, TLR4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TLR4 (66350-1-Ig) by Proteintech is a Monoclonal antibody targeting TLR4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66350-1-Ig targets TLR4 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, J774A.1 cells,  NIH\/3T3 cells,  pig liver tissue,  rat liver tissue\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTLR4, also named CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP and TRAF6, leading to NF-kB activation, cytokine secretion, and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, pig, rabbit, zebrafish, sheep\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag13857 Product name: Recombinant human TLR4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 653-839 aa of BC117422 Sequence: KFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI Predict reactive species\nFull Name: toll-like receptor 4\nCalculated Molecular Weight: 839 aa, 96 kDa\nObserved Molecular Weight: 100-110 kDa\nGenBank Accession Number: BC117422\nGene Symbol: TLR4\nGene ID (NCBI): 7099\nRRID: AB_2881730\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O00206\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887969259689,"sku":"66350-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66350-1-ig","provider":"Iright","version":"1.0","type":"link"}