{"product_id":"proteintech-66363-1-ig","title":"Proteintech, 66363-1-Ig, CHRNA5 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHRNA5 (66363-1-Ig) by Proteintech is a Monoclonal antibody targeting CHRNA5 in WB, IHC, ELISA applications with reactivity to human,  mouse, pig samples\n66363-1-Ig targets CHRNA5 in WB, IHC, IF, ELISA applications and shows reactivity with human,  mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue,  C2C12 cell,  pig skeletal muscle tissue,  A549 cells\nPositive IHC detected in: human bladder tissue,  human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. Variants in the CHRNA5 gene are associated with nicotine dependence and lung cancer risk.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4447 Product name: Recombinant human CHRNA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-251 aa of BC033639 Sequence: GAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPL Predict reactive species\nFull Name: cholinergic receptor, nicotinic, alpha 5\nCalculated Molecular Weight: 468 aa, 53 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC033639\nGene Symbol: CHRNA5\nGene ID (NCBI): 1138\nRRID: AB_2881743\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P30532\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887992787113,"sku":"66363-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66363-1-ig","provider":"Iright","version":"1.0","type":"link"}