{"product_id":"proteintech-66372-1-ig","title":"Proteintech, 66372-1-Ig, PGRMC1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGRMC1 (66372-1-Ig) by Proteintech is a Monoclonal antibody targeting PGRMC1 in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n66372-1-Ig targets PGRMC1 in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, fetal human brain tissue,  MCF-7 cells,  NIH\/3T3 cells,  HEK-293 cells,  HeLa cells,  Jurkat cells,  K-562 cells,  pig brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human ovary tumor tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human ovary tumor tissue\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProgesterone receptor membrane component 1 (PGRMC1) is a member of a multi-protein progesterone-binding complex. However, PGRMC1 shares homology with cytochrome b5-related proteins rather than hormone receptors (PMID: 18992768). It is a heme binding protein with biding sites for Src homology (SH2) and SH3 domain-containing proteins (PMID: 17583495). PGRMC1 is overexpressed in a variety of cancers, and thus represents an important biomarker for cancer progression and a potential target for anticancer drugs (PMID: 21730960). In nonmalignant tissues, PGRMC1 is highly expressed in the liver and kidney (PMID: 9705155; 20164297).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3643 Product name: Recombinant human PGRMC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-195 aa of BC034238 Sequence: YKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND Predict reactive species\nFull Name: progesterone receptor membrane component 1\nCalculated Molecular Weight: 195 aa, 22 kDa\nObserved Molecular Weight: 25-27 kDa\nGenBank Accession Number: BC034238\nGene Symbol: PGRMC1\nGene ID (NCBI): 10857\nRRID: AB_2881751\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O00264\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888070774953,"sku":"66372-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66372-1-ig","provider":"Iright","version":"1.0","type":"link"}