{"product_id":"proteintech-66390-1-ig","title":"Proteintech, 66390-1-Ig, CD74 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD74 (66390-1-Ig) by Proteintech is a Monoclonal antibody targeting CD74 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n66390-1-Ig targets CD74 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, Ramos cells,  Daudi cells\nPositive IF\/ICC detected in: Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165;PMID: 36712241).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25503 Product name: Recombinant human CD74 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-48 aa of BC018726 Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGA Predict reactive species\nFull Name: CD74 molecule, major histocompatibility complex, class II invariant chain\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC018726\nGene Symbol: CD74\nGene ID (NCBI): 972\nRRID: AB_2881766\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04233\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887999996073,"sku":"66390-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66390-1-ig","provider":"Iright","version":"1.0","type":"link"}