{"product_id":"proteintech-66394-1-ig","title":"Proteintech, 66394-1-Ig, Calbindin-D28k Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calbindin-D28k (66394-1-Ig) by Proteintech is a Monoclonal antibody targeting Calbindin-D28k in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n66394-1-Ig targets Calbindin-D28k in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rabbit brain tissue, PC-12 cells,  fetal human brain tissue,  rat brain tissue,  mouse brain tissue,  pig cerebellum tissue,  rabbit cerebellum tissue,  rat cerebellum tissue,  mouse cerebellum tissue\nPositive IHC detected in: rat cerebellum tissue, human kidney tissue,  human small intestine tissue,  human brain tissue,  mouse kidney tissue,  rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue, human kidney tissue,  rat cerebellum tissue\nPositive IF-Fro detected in: mouse cerebellum tissue, rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:8000-1:32000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)-FRO: IF-FRO : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5861 Product name: Recombinant human Calbindin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-261 aa of BC006478 Sequence: YDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN Predict reactive species\nFull Name: calbindin 1, 28kDa\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC006478\nGene Symbol: Calbindin\nGene ID (NCBI): 793\nRRID: AB_2881769\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P05937\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887989412009,"sku":"66394-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-66394-1-ig","provider":"Iright","version":"1.0","type":"link"}